Atlas Antibodies Anti-XRCC6 Antibody

상품 한눈에 보기

인간 XRCC6(KU70) 단백질을 인식하는 폴리클로날 항체로, IHC·WB·ICC 실험에 적합합니다. siRNA knockdown 및 독립 항체 비교를 통한 강화된 검증 제공. 친화성 정제 및 안정적 보존용 버퍼 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062226-100 Anti-XRCC6 Antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062226-25 Anti-XRCC6 Antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

X-ray repair complementing defective repair in Chinese hamster cells 6

IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
ICC: Suitable for immunocytochemistry.

Polyclonal antibody against Human XRCC6.

D22S671, D22S731, G22P1, KU70, ML8

항목	내용
Target Protein	X-ray repair complementing defective repair in Chinese hamster cells 6
Target Gene	XRCC6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000006392 (87%), Mouse ENSMUSG00000022471 (85%)

Antigen Sequence:

PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand