CacheBy
Atlas Antibodies Anti-XRN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XRN1 Antibody

상품 한눈에 보기

인간 XRN1 단백질을 타겟으로 하는 폴리클로날 항체로, 토끼에서 생산됨. 5'-3' exoribonuclease 1 검출에 적합하며, IHC 등 다양한 응용 가능. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간에 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035006-100 Anti-XRN1 Antibody, 5`-3` exoribonuclease 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035006-25 Anti-XRN1 Antibody, 5`-3` exoribonuclease 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XRN1 Antibody

Anti-XRN1 Antibody

Target Information

  • Target Protein: 5'-3' exoribonuclease 1
  • Target Gene: XRN1
  • Alternative Gene Name: SEP1

Product Description

Polyclonal antibody against human XRN1.
Recommended for applications such as immunohistochemistry (IHC) and related assays.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    VVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000032410): 93%
  • Rat (ENSRNOG00000042951): 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.