CacheBy
Atlas Antibodies Anti-HRH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HRH2 Antibody

상품 한눈에 보기

Human HRH2(histamine receptor H2)를 인식하는 rabbit polyclonal antibody. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 affinity purification됨. Human에 대한 verified reactivity를 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013770-100 Anti-HRH2 Antibody, histamine receptor H2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013770-25 Anti-HRH2 Antibody, histamine receptor H2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HRH2 Antibody

Anti-HRH2 Antibody

Target Information

  • Target Protein: Histamine receptor H2
  • Target Gene: HRH2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Antigen Sequence Identity
Mouse ENSMUSG00000034987 75%
Rat ENSRNOG00000018260 72%

Product Description

Polyclonal antibody against human HRH2.

Clonality & Isotype

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

Component Description
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

이미지에 표시된 텍스트: IHC (Immunohistochemistry)

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.