CacheBy
Atlas Antibodies Anti-HPRT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HPRT1 Antibody

상품 한눈에 보기

Human HPRT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반의 정교한 Orthogonal Validation 수행. 고순도 Affinity 정제 항체로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006360-100 Anti-HPRT1 Antibody, hypoxanthine phosphoribosyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006360-25 Anti-HPRT1 Antibody, hypoxanthine phosphoribosyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HPRT1 Antibody

Anti-HPRT1 Antibody

Target: hypoxanthine phosphoribosyltransferase 1 (HPRT1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation using comparison to RNA-seq data of high and low expression tissues)
  • WB
  • ICC

Product Description

Polyclonal Antibody against Human HPRT1


Alternative Gene Names

HGPRT, HPRT

Open Datasheet


Target Information

항목 내용
Target Protein hypoxanthine phosphoribosyltransferase 1
Target Gene HPRT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000025630 (98%), Rat ENSRNOG00000048561 (98%)

Antigen Sequence:
SDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMV


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.