CacheBy
Atlas Antibodies Anti-HPDL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HPDL Antibody

상품 한눈에 보기

Human HPDL 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. RNA-seq 기반 Orthogonal validation으로 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 40% glycerol/PBS buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057346-100 Anti-HPDL Antibody, 4-hydroxyphenylpyruvate dioxygenase-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057346-25 Anti-HPDL Antibody, 4-hydroxyphenylpyruvate dioxygenase-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HPDL Antibody

Anti-HPDL Antibody

Target Protein: 4-hydroxyphenylpyruvate dioxygenase-like
Supplier: Atlas Antibodies


  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human HPDL


Alternative Gene Names

4-HPPD-L, GLOXD1, MGC15668

Open Datasheet


Specifications

항목 내용
Target Protein 4-hydroxyphenylpyruvate dioxygenase-like
Target Gene HPDL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000018143 (75%), Mouse ENSMUSG00000043155 (72%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.