CacheBy
Atlas Antibodies Anti-HMOX2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HMOX2 Antibody

상품 한눈에 보기

Human HMOX2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat 및 Mouse와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040611-100 Anti-HMOX2 Antibody, heme oxygenase (decycling) 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040611-25 Anti-HMOX2 Antibody, heme oxygenase (decycling) 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HMOX2 Antibody

Anti-HMOX2 Antibody

Target Information

  • Target Protein: heme oxygenase (decycling) 2
  • Target Gene: HMOX2
  • Alternative Gene Name: HO-2

Product Description

Polyclonal antibody against Human HMOX2.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000003773 88%
Mouse ENSMUSG00000004070 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.