CacheBy
Atlas Antibodies Anti-HMMR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HMMR Antibody

상품 한눈에 보기

인간 HMMR(RHAMM)을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040025-100 Anti-HMMR Antibody, hyaluronan-mediated motility receptor (RHAMM) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040025-25 Anti-HMMR Antibody, hyaluronan-mediated motility receptor (RHAMM) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HMMR Antibody

Anti-HMMR Antibody

Target: hyaluronan-mediated motility receptor (RHAMM)
Alternative Gene Names: CD168, RHAMM
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human HMMR


Target Information

항목 내용
Target Protein hyaluronan-mediated motility receptor (RHAMM)
Target Gene HMMR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000059894 (62%), Mouse ENSMUSG00000020330 (59%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.