원본
Thermo Fisher Scientific TECTA Polyclonal Antibody
상품 한눈에 보기
TECTA 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, WB 및 IHC(P) 실험에 적합합니다. Rabbit IgG로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 인간, 생쥐, 랫트 반응성이 있으며, -20°C에서 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 06:43
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580102 TECTA Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific TECTA Polyclonal Antibody
Thermo Fisher Scientific TECTA Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93–134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747217 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Alpha-tectorin은 인간 TECTA 유전자에 의해 암호화되는 단백질로, 내이의 tectorial membrane을 구성하는 주요 비콜라겐 성분 중 하나입니다. 이 막은 감각 모세포의 stereocilia와 접촉하며, 소리 자극에 따라 세포막 전위 변화를 유도하여 음향을 전기 신호로 변환합니다.
TECTA 유전자 돌연변이는 상염색체 우성 비증후군성 난청 및 열성 형태의 선천성 감각신경성 비증후군성 난청과 관련이 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific TIE2 (TEK) Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TRF2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Synapsin II Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TEC Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.