CacheBy
Atlas Antibodies Anti-HIF1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HIF1A Antibody

상품 한눈에 보기

인간 HIF1A 단백질을 인식하는 폴리클로날 항체로, 저산소 반응 관련 연구에 적합합니다. 토끼 유래 IgG이며 PrEST 항원으로 정제되었습니다. 인간에 특이적으로 반응하며, 다양한 응용 실험에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000907-100 Anti-HIF1A Antibody, hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000907-25 Anti-HIF1A Antibody, hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HIF1A Antibody

Anti-HIF1A Antibody

Target: Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)

면역세포화학(ICC) 등 다양한 응용 가능

Product Description

Polyclonal Antibody against Human HIF1A

Alternative Gene Names

bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8

Open Datasheet

Target Information

  • Target Protein: hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
  • Target Gene: HIF1A

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008292 (88%)
  • Mouse ENSMUSG00000021109 (87%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.