CacheBy
Atlas Antibodies Anti-HIF1AN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HIF1AN Antibody

상품 한눈에 보기

Human HIF1AN 단백질을 인식하는 Rabbit Polyclonal 항체로, 저산소 유도 인자 억제 단백질 연구에 적합. ICC 등 다양한 응용에 사용 가능. PrEST 항원으로 정제되어 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와 98% 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048742-100 Anti-HIF1AN Antibody, hypoxia inducible factor 1, alpha subunit inhibitor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048742-25 Anti-HIF1AN Antibody, hypoxia inducible factor 1, alpha subunit inhibitor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HIF1AN Antibody

Anti-HIF1AN Antibody

Target: hypoxia inducible factor 1, alpha subunit inhibitor (HIF1AN)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human HIF1AN.


Alternative Gene Names

DKFZp762F1811, FIH1, FLJ20615, FLJ22027

Open Datasheet (PDF)


Target Information

  • Target Protein: hypoxia inducible factor 1, alpha subunit inhibitor
  • Target Gene: HIF1AN

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000014234 98%
Mouse ENSMUSG00000036450 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.