CacheBy
Atlas Antibodies Anti-HEPN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HEPN1 Antibody

상품 한눈에 보기

인간 HEPN1 단백질을 인식하는 폴리클로날 항체로, 간세포암 관련 연구에 적합. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 40% 글리세롤 및 PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063054-100 Anti-HEPN1 Antibody, hepatocellular carcinoma, down-regulated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063054-25 Anti-HEPN1 Antibody, hepatocellular carcinoma, down-regulated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HEPN1 Antibody

Anti-HEPN1 Antibody

Target Information

  • Target Protein: hepatocellular carcinoma, down-regulated 1
  • Target Gene: HEPN1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GLGIAPWVDGESELEFRRLGMQGPLEALRRRERNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQRPSLFI

Product Description

Polyclonal antibody against Human HEPN1.

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000068742 (27%)
  • Rat ENSRNOG00000007478 (27%)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Preservative MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.