CacheBy
Atlas Antibodies Anti-HENMT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HENMT1 Antibody

상품 한눈에 보기

Human HENMT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 재조합 단백질 발현을 통한 특이성 검증. PrEST 항원을 이용한 친화 정제 방식으로 높은 신뢰성 제공. Human에 대한 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028464-100 Anti-HENMT1 Antibody, HEN1 methyltransferase homolog 1 (Arabidopsis) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028464-25 Anti-HENMT1 Antibody, HEN1 methyltransferase homolog 1 (Arabidopsis) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HENMT1 Antibody

Anti-HENMT1 Antibody

HEN1 methyltransferase homolog 1 (Arabidopsis)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human HENMT1.


Alternative Gene Names

C1orf59, FLJ30525, HEN1

Open Datasheet


Target Information

항목 내용
Target Protein HEN1 methyltransferase homolog 1 (Arabidopsis)
Target Gene HENMT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000045662 (68%), Rat ENSRNOG00000042814 (47%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.