CacheBy
Atlas Antibodies Anti-HCAR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HCAR2 Antibody

상품 한눈에 보기

인간 HCAR2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 및 ICC에 적합하며, PrEST 항원으로 친화 정제되었습니다. HCAR2(GPR109A) 관련 연구에 활용 가능하고, 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028660-100 Anti-HCAR2 Antibody, hydroxycarboxylic acid receptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028660-25 Anti-HCAR2 Antibody, hydroxycarboxylic acid receptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HCAR2 Antibody

Anti-HCAR2 Antibody

Target: hydroxycarboxylic acid receptor 2 (HCAR2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human HCAR2.


Alternative Gene Names

GPR109A, HCA2, HM74A, NIACR1, Puma-g, PUMAG

Open Datasheet


Target Information

항목 내용
Target Protein hydroxycarboxylic acid receptor 2
Target Gene HCAR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000045502 (69%), Rat ENSRNOG00000026653 (67%)

Antigen Sequence:
NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.