
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HCFC1R1 Antibody
상품 한눈에 보기
Human HCFC1R1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며, Mouse 및 Rat과 유사성 있음.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059647-100 Anti-HCFC1R1 Antibody, host cell factor C1 regulator 1 (XPO1 dependent) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059647-25 Anti-HCFC1R1 Antibody, host cell factor C1 regulator 1 (XPO1 dependent) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HCFC1R1 Antibody
Anti-HCFC1R1 Antibody
Target: host cell factor C1 regulator 1 (XPO1 dependent)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human HCFC1R1.
Alternative Gene Names
FLJ20568, HPIP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | host cell factor C1 regulator 1 (XPO1 dependent) |
| Target Gene | HCFC1R1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000023904 (49%), Rat ENSRNOG00000003542 (46%) |
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



