CacheBy
Atlas Antibodies Anti-HAPLN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HAPLN2 Antibody

상품 한눈에 보기

Human HAPLN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 정제된 PrEST 항원을 사용해 친화 정제되었으며, 인간에 대한 검증 완료. BRAL1 유전자 대체명으로 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045765-100 Anti-HAPLN2 Antibody, hyaluronan and proteoglycan link protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045765-25 Anti-HAPLN2 Antibody, hyaluronan and proteoglycan link protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HAPLN2 Antibody

Anti-HAPLN2 Antibody

Target: hyaluronan and proteoglycan link protein 2 (HAPLN2)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
  • WB (Recombinant expression validation): Validation performed using target protein overexpression.

Product Description

Polyclonal antibody against human HAPLN2.

Alternative Gene Name: BRAL1
Open Datasheet (PDF)


Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Sequence:
    DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Mouse (ENSMUSG00000004894): 94%
    • Rat (ENSRNOG00000018870): 94%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.