
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HAPLN2 Antibody
상품 한눈에 보기
Human HAPLN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 정제된 PrEST 항원을 사용해 친화 정제되었으며, 인간에 대한 검증 완료. BRAL1 유전자 대체명으로 알려져 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045765-100 Anti-HAPLN2 Antibody, hyaluronan and proteoglycan link protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045765-25 Anti-HAPLN2 Antibody, hyaluronan and proteoglycan link protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HAPLN2 Antibody
Anti-HAPLN2 Antibody
Target: hyaluronan and proteoglycan link protein 2 (HAPLN2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Recombinant expression validation): Validation performed using target protein overexpression.
Product Description
Polyclonal antibody against human HAPLN2.
Alternative Gene Name: BRAL1
Open Datasheet (PDF)
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000004894): 94%
- Rat (ENSRNOG00000018870): 94%
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



