CacheBy
Atlas Antibodies Anti-HAO2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HAO2 Antibody

상품 한눈에 보기

인간 HAO2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. WB 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 대한 반응성 검증 완료. 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050355-100 Anti-HAO2 Antibody, hydroxyacid oxidase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050355-25 Anti-HAO2 Antibody, hydroxyacid oxidase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HAO2 Antibody

Anti-HAO2 Antibody

Target Protein: hydroxyacid oxidase 2
Supplier: Atlas Antibodies


  • Western Blot (WB)

Product Description

Polyclonal antibody against human HAO2.


Alternative Gene Names

  • GIG16
  • HAOX2

Open Datasheet


Target Information

항목 내용
Target Protein hydroxyacid oxidase 2
Target Gene HAO2
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019470 (60%), Mouse ENSMUSG00000027870 (53%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.