CacheBy
Atlas Antibodies Anti-HACL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HACL1 Antibody

상품 한눈에 보기

Human HACL1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat에서 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035497-100 Anti-HACL1 Antibody, 2-hydroxyacyl-CoA lyase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035497-25 Anti-HACL1 Antibody, 2-hydroxyacyl-CoA lyase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HACL1 Antibody

Anti-HACL1 Antibody

Target Information

  • Target Protein: 2-hydroxyacyl-CoA lyase 1
  • Target Gene: HACL1
  • Alternative Gene Names: 2-HPCL, HPCL, PHYH2
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human HACL1.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    CVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQ

Species Reactivity

  • Verified: Human, Mouse, Rat
  • Interspecies Information:
    • Mouse (ENSMUSG00000021884): 90% identity
    • Rat (ENSRNOG00000019630): 87% identity

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Note Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.