Atlas Antibodies Anti-HAAO Antibody

상품 한눈에 보기

인간 HAAO 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합. 친화 정제된 고순도 항체로 사람, 쥐, 생쥐에 반응. 연구용으로 안정적인 보존 및 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042024-100 Anti-HAAO Antibody, 3-hydroxyanthranilate 3,4-dioxygenase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042024-25 Anti-HAAO Antibody, 3-hydroxyanthranilate 3,4-dioxygenase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-HAAO Antibody

Anti-HAAO Antibody

Target Protein: 3-hydroxyanthranilate 3,4-dioxygenase
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human HAAO.
Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	3-hydroxyanthranilate 3,4-dioxygenase
Target Gene	HAAO
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	AWVKENRGSFQPPVCNKLMHQEQLKVMFVGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQ
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000031263 (94%), Mouse ENSMUSG00000000673 (92%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.