CacheBy
Atlas Antibodies Anti-H1FX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-H1FX Antibody

상품 한눈에 보기

Human H1FX 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원을 사용해 친화 정제되었습니다. 인간 반응성이 검증되었으며, 40% glycerol/PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040099-100 Anti-H1FX Antibody, H1 histone family, member X 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040099-25 Anti-H1FX Antibody, H1 histone family, member X 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-H1FX Antibody

Anti-H1FX Antibody

Target Information

  • Target Protein: H1 histone family, member X
  • Target Gene: H1FX
  • Alternative Gene Names: H1X, MGC15959, MGC8350
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human H1FX.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    ALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000044927): 74%
  • Rat (ENSRNOG00000027722): 73%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.