Atlas Antibodies Anti-H1FNT Antibody

상품 한눈에 보기

Human H1FNT 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 정제되었습니다. Human에 특이적이며, 고순도 PBS/glycerol buffer에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046204-100 Anti-H1FNT Antibody, H1 histone family, member N, testis-specific 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046204-25 Anti-H1FNT Antibody, H1 histone family, member N, testis-specific 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Human H1 histone family, member N (testis-specific) 단백질을 인식하는 폴리클로날 항체입니다.

Polyclonal Antibody against Human H1FNT

항목	내용
Target Protein	H1 histone family, member N, testis-specific
Target Gene	H1FNT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000029545 (48%), Mouse ENSMUSG00000048077 (47%)

Antigen Sequence:
MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand