CacheBy
Atlas Antibodies Anti-GSPT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSPT2 Antibody

상품 한눈에 보기

Human GSPT2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB(Orthogonal), ICC 등 다양한 응용에 적합. eRF3b로도 알려진 GSPT2 단백질 검출용으로 개발되었으며, PrEST 항원으로 친화 정제됨. Human에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044769-100 Anti-GSPT2 Antibody, G1 to S phase transition 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044769-25 Anti-GSPT2 Antibody, G1 to S phase transition 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSPT2 Antibody

Anti-GSPT2 Antibody

G1 to S phase transition 2


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)
    • Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human GSPT2


Alternative Gene Names

eRF3b, FLJ10441

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein G1 to S phase transition 2
Target Gene GSPT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000048817 (64%), Mouse ENSMUSG00000071723 (63%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.