Atlas Antibodies Anti-GSN Antibody

상품 한눈에 보기

Human GSN 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western Blot에 적합. Rabbit에서 유래한 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054026-100 Anti-GSN Antibody, gelsolin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054026-25 Anti-GSN Antibody, gelsolin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GSN Antibody

Anti-GSN Antibody

Target Information

Target Protein: gelsolin
Target Gene: GSN
Alternative Gene Names: DKFZp313L0718

Product Description

Polyclonal antibody against Human GSN (gelsolin).
Produced in rabbit and affinity purified using the PrEST antigen as ligand.
Recommended for use in immunohistochemistry (IHC) and Western blot (WB).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000018991 (92%)
Mouse ENSMUSG00000026879 (91%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand