CacheBy
Atlas Antibodies Anti-GSN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSN Antibody

상품 한눈에 보기

Human GSN 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western Blot에 적합. Rabbit에서 유래한 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054026-100 Anti-GSN Antibody, gelsolin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054026-25 Anti-GSN Antibody, gelsolin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSN Antibody

Anti-GSN Antibody

Target Information

  • Target Protein: gelsolin
  • Target Gene: GSN
  • Alternative Gene Names: DKFZp313L0718

Product Description

Polyclonal antibody against Human GSN (gelsolin).
Produced in rabbit and affinity purified using the PrEST antigen as ligand.
Recommended for use in immunohistochemistry (IHC) and Western blot (WB).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000018991 (92%)
  • Mouse ENSMUSG00000026879 (91%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended
WB Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.