Atlas Antibodies Anti-WNT10B Antibody

상품 한눈에 보기

Human WNT10B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 고순도의 Affinity 정제 항체로 신뢰성 높은 단백질 발현 분석에 활용 가능합니다.

카탈로그번호: HPA062539-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062539-100 Anti-WNT10B Antibody, wingless-type MMTV integration site family, member 10B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062539-25 Anti-WNT10B Antibody, wingless-type MMTV integration site family, member 10B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-WNT10B Antibody

Anti-WNT10B Antibody

Target: wingless-type MMTV integration site family, member 10B (WNT10B)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal antibody against human WNT10B.

Alternative Gene Names

SHFM6
WNT-12

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	wingless-type MMTV integration site family, member 10B
Target Gene	WNT10B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000061238 (95%), Mouse ENSMUSG00000022996 (93%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand