CacheBy
Atlas Antibodies Anti-WNK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WNK2 Antibody

상품 한눈에 보기

인간 WNK2 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 응용에 적합. RNA-seq 기반 orthogonal validation으로 단백질 발현 검증. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간에 높은 반응성(97% mouse/rat ortholog identity).

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA015555-100 Anti-WNK2 Antibody, WNK lysine deficient protein kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015555-25 Anti-WNK2 Antibody, WNK lysine deficient protein kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WNK2 Antibody

Anti-WNK2 Antibody

WNK lysine deficient protein kinase 2

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human WNK2

Alternative Gene Names

KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43

Open Datasheet

Target Information

항목 내용
Target Protein WNK lysine deficient protein kinase 2
Target Gene WNK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASST

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000037989 (97%)
  • Rat ENSRNOG00000016684 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.