Atlas Antibodies Anti-WNK2 Antibody

상품 한눈에 보기

인간 WNK2 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 응용에 적합. RNA-seq 기반 orthogonal validation으로 단백질 발현 검증. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간에 높은 반응성(97% mouse/rat ortholog identity).

카탈로그번호: HPA015555-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA015555-100 Anti-WNK2 Antibody, WNK lysine deficient protein kinase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA015555-25 Anti-WNK2 Antibody, WNK lysine deficient protein kinase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-WNK2 Antibody

Anti-WNK2 Antibody

WNK lysine deficient protein kinase 2

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human WNK2

Alternative Gene Names

KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43

Open Datasheet

Target Information

항목	내용
Target Protein	WNK lysine deficient protein kinase 2
Target Gene	WNK2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASST

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000037989 (97%)
Rat ENSRNOG00000016684 (97%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand