CacheBy
Atlas Antibodies Anti-WDTC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDTC1 Antibody

상품 한눈에 보기

인체 WDTC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증을 거쳤으며, 토끼 유래 IgG 형식입니다. 고순도 친화성 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028182-100 Anti-WDTC1 Antibody, WD and tetratricopeptide repeats 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028182-25 Anti-WDTC1 Antibody, WD and tetratricopeptide repeats 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDTC1 Antibody

Anti-WDTC1 Antibody

WD and tetratricopeptide repeats 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal Antibody against Human WDTC1

Alternative Gene Names

ADP, DCAF9, KIAA1037

Open Datasheet

Target Information

항목 내용
Target Protein WD and tetratricopeptide repeats 1
Target Gene WDTC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000037622 (100%), Rat ENSRNOG00000008377 (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

DDQHTIVWDPLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTFWSAAE

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.