CacheBy
Atlas Antibodies Anti-WEE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WEE1 Antibody

상품 한눈에 보기

인간 WEE1 G2 체크포인트 키나아제에 대한 폴리클로날 항체로, WB 및 ICC 응용에 추천됩니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원을 이용해 친화 정제되었고, 인간에 대해 검증된 반응성을 가집니다.

카탈로그번호
HPA068845-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068845-100 Anti-WEE1 Antibody, WEE1 G2 checkpoint kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068845-25 Anti-WEE1 Antibody, WEE1 G2 checkpoint kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WEE1 Antibody

Anti-WEE1 Antibody

Target Information

  • Target Protein: WEE1 G2 checkpoint kinase
  • Target Gene: WEE1
  • Alternative Gene Names: WEE1A
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human WEE1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031016 (95%)
  • Rat ENSRNOG00000010017 (95%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.