AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WDR54 Antibody
상품 한눈에 보기
인체 WDR54 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 정제된 PrEST 항원 기반 친화 정제 방식으로 제조되었습니다. 토끼 유래 IgG로, 글리세롤 및 PBS 완충액에 보존되어 있습니다.
- 카탈로그번호
- HPA053558-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053558-100 Anti-WDR54 Antibody, WD repeat domain 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053558-25 Anti-WDR54 Antibody, WD repeat domain 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WDR54 Antibody
Anti-WDR54 Antibody
Target: WD repeat domain 54
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data from tissues with high and low target expression.
- WB (Western Blot)
Product Description
Polyclonal antibody against Human WDR54.
Alternative Gene Names
- FLJ12953
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat domain 54 |
| Target Gene | WDR54 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RVLVFDIPAKGPNIVLSEELAGHQMPITDIATEPAQGQDCVADMVTADDSGLLCVWRSGPEFTLLTRIPGFGVPCPS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000030032 | 95% |
| Rat | ENSRNOG00000060514 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and experimental conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.