Atlas Antibodies Anti-WDR55 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA043470-100 | - | Atlas Antibodies HPA043470-100 Anti-WDR55 Antibody, WD repeat domain 55 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA043470-25 | - | Atlas Antibodies HPA043470-25 Anti-WDR55 Antibody, WD repeat domain 55 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-WDR55 Antibody
WD repeat domain 55
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human WDR55
Alternative Gene Names
FLJ20195, FLJ21702
Target Protein
WD repeat domain 55
Target Gene
WDR55
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
SVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGH
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000017251 (93%)
Mouse ENSMUSG00000042660 (91%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|