CacheBy
Atlas Antibodies Anti-VWDE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VWDE Antibody

상품 한눈에 보기

Human VWDE 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성을 보입니다. 40% 글리세롤 기반 완충액에 보존되어 있습니다.

카탈로그번호
HPA026619-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026619-100 Anti-VWDE Antibody, von Willebrand factor D and EGF domains 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026619-25 Anti-VWDE Antibody, von Willebrand factor D and EGF domains 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VWDE Antibody

Anti-VWDE Antibody

Target Information

  • Target Protein: von Willebrand factor D and EGF domains
  • Target Gene: VWDE
  • Alternative Gene Name: FLJ14712

Product Description

Polyclonal antibody against human VWDE, designed for use in immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    YRSVRFDSWHLQQSAVQDLICDHSLSPGWYRFLILDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLFSTTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCA

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000079679): 90%
    • Rat (ENSRNOG00000024709): 87%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Store as recommended by manufacturer.
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.