CacheBy
Atlas Antibodies Anti-VWCE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VWCE Antibody

상품 한눈에 보기

인간 VWCE 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human 반응성이 검증되었고, 40% glycerol/PBS buffer에 보존됩니다.

카탈로그번호
HPA040401-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040401-100 Anti-VWCE Antibody, von Willebrand factor C and EGF domains 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040401-25 Anti-VWCE Antibody, von Willebrand factor C and EGF domains 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VWCE Antibody

Anti-VWCE Antibody

Target Information

  • Target Protein: von Willebrand factor C and EGF domains
  • Target Gene: VWCE
  • Alternative Gene Names: FLJ32009, URG11, VWC1

Product Description

Polyclonal antibody against human VWCE (von Willebrand factor C and EGF domains).
Recommended for applications such as immunohistochemistry (IHC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG

Species Reactivity

  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Mouse (ENSMUSG00000043789): 83% identity
    • Rat (ENSRNOG00000060269): 81% identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도와 조건은 사용자가 결정해야 합니다.

Additional Resources

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.