CacheBy
Atlas Antibodies Anti-VPS25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS25 Antibody

상품 한눈에 보기

Human VPS25 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종 간 반응성(인간, 마우스, 랫트 100%)을 보입니다. 안정적인 PBS/glycerol buffer로 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052217-100 Anti-VPS25 Antibody, vacuolar protein sorting 25 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052217-25 Anti-VPS25 Antibody, vacuolar protein sorting 25 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS25 Antibody

Anti-VPS25 Antibody

Target: vacuolar protein sorting 25 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human VPS25


Alternative Gene Names

DERP9, EAP20, MGC10540

Open Datasheet


Target Information

항목 내용
Target Protein vacuolar protein sorting 25 homolog (S. cerevisiae)
Target Gene VPS25
Verified Species Reactivity Human
Interspecies Identity Rat (100%), Mouse (100%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.