CacheBy
Atlas Antibodies Anti-VPS25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS25 Antibody

상품 한눈에 보기

Human VPS25 단백질을 표적으로 하는 rabbit polyclonal antibody. IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 affinity purification 수행. 높은 종간 보존성으로 rat 및 mouse에서도 100% 일치. 안정적 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057284-100 Anti-VPS25 Antibody, vacuolar protein sorting 25 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057284-25 Anti-VPS25 Antibody, vacuolar protein sorting 25 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS25 Antibody

Anti-VPS25 Antibody

Target: vacuolar protein sorting 25 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VPS25.


Alternative Gene Names

DERP9, EAP20, MGC10540

Open Datasheet


Target Information

항목 내용
Target Protein vacuolar protein sorting 25 homolog (S. cerevisiae)
Target Gene VPS25
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000051179 (100%), Mouse ENSMUSG00000078656 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.