Atlas Antibodies Anti-UTP18 Antibody

상품 한눈에 보기

Human UTP18 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식 적용. 인체 반응성이 검증된 고품질 연구용 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052378-100 Anti-UTP18 Antibody, UTP18 small subunit (SSU) processome component homolog (yeast) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052378-25 Anti-UTP18 Antibody, UTP18 small subunit (SSU) processome component homolog (yeast) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Human UTP18 small subunit (SSU) processome component homolog (yeast)에 대한 폴리클로날 항체입니다.

항목	내용
Target Protein	UTP18 small subunit (SSU) processome component homolog (yeast)
Target Gene	UTP18
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000002644 (81%), Mouse ENSMUSG00000054079 (76%)

Antigen Sequence:
HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand