Atlas Antibodies Anti-UTP3 Antibody

상품 한눈에 보기

Human UTP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat, Mouse에서도 높은 유사도를 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035655-100 Anti-UTP3 Antibody, UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035655-25 Anti-UTP3 Antibody, UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)

Polyclonal antibody against Human UTP3.

CRLZ1, DKFZp761F222, FLJ23256, SAS10

항목	내용
Target Protein	UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Target Gene	UTP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000003599 (95%), Mouse ENSMUSG00000070697 (90%)

Antigen Sequence:

LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet