CacheBy
Atlas Antibodies Anti-URGCP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-URGCP Antibody

상품 한눈에 보기

Human URGCP 단백질을 인식하는 Rabbit Polyclonal 항체로, 세포 증식 조절 연구에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029468-100 Anti-URGCP Antibody, upregulator of cell proliferation 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029468-25 Anti-URGCP Antibody, upregulator of cell proliferation 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-URGCP Antibody

Anti-URGCP Antibody

Target Information

  • Target Protein: Upregulator of Cell Proliferation
  • Target Gene: URGCP
  • Alternative Gene Names: DKFZp666G166, DKFZp686O0457, FLJ20654, KIAA1507, URG4

Product Description

Polyclonal antibody against human URGCP.
Recommended for research applications related to cell proliferation regulation.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PSLSEKQYFLRWMEWGLARVAQPRLRQPPETLLTLRPKHGGTTDVGEPLWPEPLGVEHFLREMGQFYEAESCLVEAGRLPAGQRRFAHFP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000012184 (89%)
  • Mouse: ENSMUSG00000049680 (88%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 실험 응용에 맞는 최적 농도와 조건은 사용자가 직접 확인해야 합니다.

Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.