Atlas Antibodies Anti-UQCRFS1 Antibody

상품 한눈에 보기

Human UQCRFS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation을 통해 검증된 신뢰성 높은 제품. RIP1, RIS1, RISP, UQCR5 유전자 대체명 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050339-100 Anti-UQCRFS1 Antibody, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050339-25 Anti-UQCRFS1 Antibody, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-UQCRFS1 Antibody

Anti-UQCRFS1 Antibody

Target: ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저발현 조직 간 검증
WB (Independent validation): 서로 다른 에피토프를 인식하는 독립 항체 간 발현 비교를 통한 검증
ICC: 세포 내 단백질 검출에 적합

Product Description

Polyclonal antibody against Human UQCRFS1

Alternative Gene Names

RIP1, RIS1, RISP, UQCR5

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
Target Gene	UQCRFS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
Verified Species Reactivity	Human, Rat
Interspecies Identity	Rat ENSRNOG00000018281 (94%), Mouse ENSMUSG00000038462 (94%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand