CacheBy
Atlas Antibodies Anti-UHRF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UHRF2 Antibody

상품 한눈에 보기

Human UHRF2 단백질을 인식하는 Rabbit Polyclonal 항체로, E3 ubiquitin ligase 관련 연구에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026633-100 Anti-UHRF2 Antibody, ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026633-25 Anti-UHRF2 Antibody, ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UHRF2 Antibody

Anti-UHRF2 Antibody

Target: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Type: Polyclonal Antibody against Human UHRF2


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human UHRF2 (ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase).


Alternative Gene Names

MGC33463, NIRF, RNF107, URF2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Target Gene UHRF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011308 (81%), Mouse ENSMUSG00000024817 (81%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.