CacheBy
Atlas Antibodies Anti-UHRF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UHRF1 Antibody

상품 한눈에 보기

Human UHRF1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 독립 항체 검증을 통해 높은 신뢰성 제공. Rabbit 유래 IgG 형식으로 PrEST 항원 친화 정제. Human 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055446-100 Anti-UHRF1 Antibody, ubiquitin like with PHD and ring finger domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055446-25 Anti-UHRF1 Antibody, ubiquitin like with PHD and ring finger domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UHRF1 Antibody

Anti-UHRF1 Antibody

ubiquitin-like with PHD and ring finger domains 1


  • IHC Independent Validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • ICC

Product Description

Polyclonal Antibody against Human UHRF1


Alternative Gene Names

FLJ21925, ICBP90, Np95, RNF106, TDRD22

Open Datasheet


Target Information

항목 내용
Target Protein ubiquitin-like with PHD and ring finger domains 1
Target Gene UHRF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000048411 (67%), Mouse ENSMUSG00000001228 (65%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.