
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TXNDC5 Antibody
상품 한눈에 보기
Human TXNDC5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Orthogonal 및 Independent validation을 통해 검증된 신뢰성 높은 항체입니다. Endoplasmic reticulum 내 thioredoxin domain containing 5 단백질 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034677-100 Anti-TXNDC5 Antibody, thioredoxin domain containing 5 (endoplasmic reticulum) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034677-25 Anti-TXNDC5 Antibody, thioredoxin domain containing 5 (endoplasmic reticulum) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TXNDC5 Antibody
Anti-TXNDC5 Antibody
Target: thioredoxin domain containing 5 (endoplasmic reticulum)
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human TXNDC5
Alternative Gene Names
EndoPDI, ERp46, FLJ21353, FLJ90810, Hcc-2, MGC3178, PDIA15
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | thioredoxin domain containing 5 (endoplasmic reticulum) |
| Target Gene | TXNDC5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDC |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000038991 (93%) Rat ENSRNOG00000013469 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



