CacheBy
Atlas Antibodies Anti-TXNDC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXNDC5 Antibody

상품 한눈에 보기

Human TXNDC5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Orthogonal 및 Independent validation을 통해 검증된 신뢰성 높은 항체입니다. Endoplasmic reticulum 내 thioredoxin domain containing 5 단백질 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034677-100 Anti-TXNDC5 Antibody, thioredoxin domain containing 5 (endoplasmic reticulum) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034677-25 Anti-TXNDC5 Antibody, thioredoxin domain containing 5 (endoplasmic reticulum) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXNDC5 Antibody

Anti-TXNDC5 Antibody

Target: thioredoxin domain containing 5 (endoplasmic reticulum)


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human TXNDC5


Alternative Gene Names

EndoPDI, ERp46, FLJ21353, FLJ90810, Hcc-2, MGC3178, PDIA15

Open Datasheet


Target Information

항목 내용
Target Protein thioredoxin domain containing 5 (endoplasmic reticulum)
Target Gene TXNDC5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDC
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000038991 (93%)
Rat ENSRNOG00000013469 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.