CacheBy
Atlas Antibodies Anti-TXNDC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXNDC2 Antibody

상품 한눈에 보기

Human TXNDC2 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 기반 Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human에 반응하며, SPTRX1 유전자 대체명으로도 알려짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018817-100 Anti-TXNDC2 Antibody, thioredoxin domain containing 2 (spermatozoa) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018817-25 Anti-TXNDC2 Antibody, thioredoxin domain containing 2 (spermatozoa) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXNDC2 Antibody

Anti-TXNDC2 Antibody

Target: thioredoxin domain containing 2 (spermatozoa)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human TXNDC2


Alternative Gene Names

SPTRX1

Open Datasheet


Target Information

항목 내용
Target Protein thioredoxin domain containing 2 (spermatozoa)
Target Gene TXNDC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQAKEKAFLPMVSHTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQP

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000050612 44%
Rat ENSRNOG00000027916 34%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.