AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TTC9B Antibody
상품 한눈에 보기
Human TTC9B 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 등 다양한 연구 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042496-100 Anti-TTC9B Antibody, tetratricopeptide repeat domain 9B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042496-25 Anti-TTC9B Antibody, tetratricopeptide repeat domain 9B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TTC9B Antibody
Anti-TTC9B Antibody
Target Information
- Protein: Tetratricopeptide repeat domain 9B
- Gene: TTC9B
- Alternative Gene Name: FLJ30373
Product Description
Polyclonal antibody against human TTC9B, produced in rabbit.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
HGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKFREAI
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000018850): 91%
- Mouse (ENSMUSG00000007944): 91%
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.