CacheBy
Atlas Antibodies Anti-TTC7B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC7B Antibody

상품 한눈에 보기

인간 TTC7B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 정합 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 글리세롤/PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058363-100 Anti-TTC7B Antibody, tetratricopeptide repeat domain 7B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058363-25 Anti-TTC7B Antibody, tetratricopeptide repeat domain 7B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC7B Antibody

Anti-TTC7B Antibody

Target: tetratricopeptide repeat domain 7B (TTC7B)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human TTC7B.


Alternative Gene Names

  • TTC7L1

Target Information

항목 내용
Target Protein tetratricopeptide repeat domain 7B
Target Gene TTC7B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEHPLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDY
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033530 (95%), Rat ENSRNOG00000014879 (35%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.