CacheBy
Atlas Antibodies Anti-TTC21A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC21A Antibody

상품 한눈에 보기

Human TTC21A 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며 RNA-seq 기반 직교 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 글리세롤 함유 완충액으로 안정한 장기 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035510-100 Anti-TTC21A Antibody, tetratricopeptide repeat domain 21A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035510-25 Anti-TTC21A Antibody, tetratricopeptide repeat domain 21A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC21A Antibody

Anti-TTC21A Antibody

Target: tetratricopeptide repeat domain 21A (TTC21A)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • ICC

Product Description

Polyclonal antibody against human TTC21A.
Validated for immunohistochemistry and immunocytochemistry applications.


Alternative Gene Names

  • STI2

Target Information

항목 내용
Target Protein tetratricopeptide repeat domain 21A
Target Gene TTC21A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QGAESNYMEKKELEQQGVSTAEKLLREFYPHSDSSQTQLRLLQGLCRLATREKANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPK
Verified Species Reactivity Human
Interspecies Identity Rat (72%, ENSRNOG00000034089), Mouse (72%, ENSMUSG00000032514)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.