
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TTC14 Antibody
상품 한눈에 보기
Human TTC14 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. TTC14 유전자 단백질 연구에 활용되며, PrEST 항원으로 친화 정제되었습니다. 사람과 생쥐에 반응하며, 40% 글리세롤/PBS 완충액에 보존됩니다.
- 카탈로그번호
- HPA009295-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA009295-100 Anti-TTC14 Antibody, tetratricopeptide repeat domain 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009295-25 Anti-TTC14 Antibody, tetratricopeptide repeat domain 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TTC14 Antibody
Anti-TTC14 Antibody
Target: tetratricopeptide repeat domain 14 (TTC14)
Type: Polyclonal Antibody against Human TTC14
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human TTC14 protein.
Alternative Gene Names
- FLJ00166
- KIAA1980
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tetratricopeptide repeat domain 14 |
| Target Gene | TTC14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALALDET |
Verified Species Reactivity
- Human
- Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000027677 (99%)
- Rat ENSRNOG00000011261 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



