CacheBy
Atlas Antibodies Anti-TTC14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC14 Antibody

상품 한눈에 보기

Human TTC14 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. TTC14 유전자 단백질 연구에 활용되며, PrEST 항원으로 친화 정제되었습니다. 사람과 생쥐에 반응하며, 40% 글리세롤/PBS 완충액에 보존됩니다.

카탈로그번호
HPA009295-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009295-100 Anti-TTC14 Antibody, tetratricopeptide repeat domain 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009295-25 Anti-TTC14 Antibody, tetratricopeptide repeat domain 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC14 Antibody

Anti-TTC14 Antibody

Target: tetratricopeptide repeat domain 14 (TTC14)
Type: Polyclonal Antibody against Human TTC14


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human TTC14 protein.


Alternative Gene Names

  • FLJ00166
  • KIAA1980

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tetratricopeptide repeat domain 14
Target Gene TTC14
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALALDET

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000027677 (99%)
  • Rat ENSRNOG00000011261 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.