Atlas Antibodies Anti-GPR37L1 Antibody

상품 한눈에 보기

인간 GPR37L1 단백질에 특이적인 폴리클로날 항체로, 정제된 Rabbit IgG 형식입니다. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인할 수 있습니다. 고순도 PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064454-100 Anti-GPR37L1 Antibody, G protein-coupled receptor 37 like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064454-25 Anti-GPR37L1 Antibody, G protein-coupled receptor 37 like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPR37L1 Antibody

Anti-GPR37L1 Antibody

G protein-coupled receptor 37 like 1

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human GPR37L1

Alternative Gene Names

ETBR-LP-2

Open Datasheet

Target Information

항목	내용
Target Protein	G protein-coupled receptor 37 like 1
Target Gene	GPR37L1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000006237 (81%), Mouse ENSMUSG00000026424 (77%)

Antigen Sequence:

AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet