CacheBy
Atlas Antibodies Anti-GPR34 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR34 Antibody

상품 한눈에 보기

Human GPR34 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, PBS와 glycerol buffer에 보존됨. 인간 GPR34 연구용으로 검증된 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010668-100 Anti-GPR34 Antibody, G protein-coupled receptor 34 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010668-25 Anti-GPR34 Antibody, G protein-coupled receptor 34 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR34 Antibody

Anti-GPR34 Antibody

Target Information

  • Target Protein: G protein-coupled receptor 34
  • Target Gene: GPR34
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000040229): 65%
  • Rat (ENSRNOG00000039759): 55%

Product Description

Polyclonal Antibody against Human GPR34.

Clonality and Host

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.