CacheBy
Atlas Antibodies Anti-TSBP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSBP1 Antibody

상품 한눈에 보기

Human TSBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제되었습니다. ICC 등 다양한 응용에 적합하며, 40% glycerol 및 PBS buffer에 보존됩니다. TSBP, C6orf10 유전자 연구용으로 사용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047479-100 Anti-TSBP1 Antibody, chromosome 6 open reading frame 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047479-25 Anti-TSBP1 Antibody, chromosome 6 open reading frame 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSBP1 Antibody

Anti-TSBP1 Antibody

Target: chromosome 6 open reading frame 10 (TSBP1)
Supplier: Atlas Antibodies


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TSBP1.


Alternative Gene Names

  • TSBP
  • C6orf10

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 6 open reading frame 10
Target Gene TSBP1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence ILTGYMDEELAKKSCSKIQILKCGGTARSQNSREENKEALKNDIIFTNSVESLKSAHIKEPEREGKGTDLEKDKIGMEVKVDSDAGIP

Antibody Properties

항목 내용
Verified Species Reactivity Human
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.