CacheBy
Atlas Antibodies Anti-TRUB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRUB2 Antibody

상품 한눈에 보기

인간 TRUB2 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. 토끼에서 생산된 IgG 항체로 높은 특이성과 재현성을 제공. PrEST 항원으로 친화 정제되어 높은 순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021211-100 Anti-TRUB2 Antibody, TruB pseudouridine (psi) synthase family member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021211-25 Anti-TRUB2 Antibody, TruB pseudouridine (psi) synthase family member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRUB2 Antibody

Anti-TRUB2 Antibody

TruB pseudouridine (psi) synthase family member 2

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TRUB2.

Alternative Gene Names

  • CLONE24922

Open Datasheet

Target Information

항목 내용
Target Protein TruB pseudouridine (psi) synthase family member 2
Target Gene TRUB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000039826 (86%), Rat ENSRNOG00000043189 (83%)

Antigen Sequence

AFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.