CacheBy
Atlas Antibodies Anti-TRH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRH Antibody

상품 한눈에 보기

Human TRH 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC Orthogonal validation을 통해 검증됨. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 시료에 적합하며 PBS/glycerol buffer로 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035596-100 Anti-TRH Antibody, thyrotropin-releasing hormone 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035596-25 Anti-TRH Antibody, thyrotropin-releasing hormone 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRH Antibody

Anti-TRH Antibody

Target: Thyrotropin-releasing hormone (TRH)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human TRH
Open Datasheet (PDF)


Specifications

항목 내용
Target Protein Thyrotropin-releasing hormone
Target Gene TRH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000005892 (51%), Rat ENSRNOG00000011824 (50%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

HKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEE

Material Safety

Material Safety Data Sheet (MSDS)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.