CacheBy
Atlas Antibodies Anti-TRHR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRHR Antibody

상품 한눈에 보기

Human TRHR(Thyrotropin Releasing Hormone Receptor)를 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인체 반응 검증 완료, 40% glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055162-100 Anti-TRHR Antibody, thyrotropin releasing hormone receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055162-25 Anti-TRHR Antibody, thyrotropin releasing hormone receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRHR Antibody

Anti-TRHR Antibody

Target Information

  • Target Protein: Thyrotropin Releasing Hormone Receptor (TRHR)
  • Target Gene: TRHR
  • Antigen Sequence:
    ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
    (Recombinant Protein Epitope Signature Tag, PrEST)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000005048 (92%)
  • Mouse ENSMUSG00000038760 (88%)

Product Description

Polyclonal antibody against Human TRHR, suitable for various applications including immunohistochemistry (IHC).

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.